PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00110.53
Common NameAMTR_s00110p00091490, LOC18427972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 273aa    MW: 30474.6 Da    PI: 8.4362
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00110.53genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.2e-33139196259
                                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                              +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  evm_27.model.AmTr_v1.0_scaffold00110.53 139 EDGYRWRKYGQKAVKNSPFPRSYYRCTNQKCTVKKRVERSSEDPSIVVTTYEGQHCHH 196
                                              8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.1E-34123197IPR003657WRKY domain
SuperFamilySSF1182901.27E-28130196IPR003657WRKY domain
PROSITE profilePS5081129.861133198IPR003657WRKY domain
SMARTSM007742.4E-39138197IPR003657WRKY domain
PfamPF031069.1E-26139196IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDEKKPNPKS TFSSDFSSSE TTIDSMASSS YLIGDQSDEL LSGFEWGGYS GFQAFLEEFS  60
GQKVPENHSW PQFPATTKPG EASTPNLSVS SSSSDDLSTK PSDDTKPDQK KNKEKKKGQK  120
RIRQPRFAFM TKSEVDHLED GYRWRKYGQK AVKNSPFPRS YYRCTNQKCT VKKRVERSSE  180
DPSIVVTTYE GQHCHHTVSF SRGNPGPREG AFQEQIPTSS SNRYFPPMQF RSVVPPQVQL  240
GQAARISNDQ STEIQNDEGL LGDIVPGSMR ST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-26128195774Probable WRKY transcription factor 4
2lex_A1e-26128195774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006837076.10.0PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9831e-62WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLW1NZ090.0W1NZ09_AMBTC; Uncharacterized protein
STRINGVIT_01s0011g00720.t019e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-55WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]